The domain within your query sequence starts at position 73 and ends at position 127; the E-value for the FANCL_C domain shown below is 4.2e-19.

FSMDCGICYARHLNGAIPDQVCNNPQCGQPFHEICLYENKASQSPSGWHVSADMI

FANCL_C

 FANCL_C
PFAM accession number:PF11793
Interpro abstract (IPR026850):

This entry represents the C-terminal domain of the FANCL, which is the E3 ubiquitin ligase subunit of the FA (Fanconi anaemia) complex [ (PUBMED:16474167) (PUBMED:21775430) (PUBMED:24389026) (PUBMED:20154706) ]. This entry also consists of structure-specific endonuclease subunit slx1.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FANCL_C