The domain within your query sequence starts at position 657 and ends at position 770; the E-value for the FANCM-MHF_bd domain shown below is 8.5e-50.
NKDGLLSEEEFNLWSRLYRLGDSDQVKGVALPQSHFPSLQEDRVIQDPTTRIHQLSLSEW SLWQDRPLPTHQVDHSDRCHHFISIMKMIEGMRHEEGECSYELKIRPFLQMEDV
FANCM-MHF_bd |
---|
PFAM accession number: | PF16783 |
---|---|
Interpro abstract (IPR031879): | This entry represents a structured region found in the Fanconi anemia group M protein (FANCM) that binds to a two-histone-fold-containing protein complex MHF. MHF binds double-strand DNA, stimulates the DNA-binding activity of FANCM, and contributes to the targeting of FANCM to chromatin [ (PUBMED:22510687) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FANCM-MHF_bd