The domain within your query sequence starts at position 431 and ends at position 486; the E-value for the FAO_M domain shown below is 9.2e-22.

HGRPEKDMYSYDIRRFHHSLTDHTRWIRERSHESYAKNYSVVFPHDEPLAGRNMRR

FAO_M

• PFAM accession number: PF16350
• Interpro abstract (IPR032503):

  This domain occurs in several FAD dependent oxidoreductases: sarcosine dehydrogenase, dimethylglycine dehydrogenase and dimethylglycine oxidase. It's function is not known.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAO_M