The domain within your query sequence starts at position 560 and ends at position 628; the E-value for the FAST_1 domain shown below is 6.6e-25.

LAIILPFSILNYDPPQKDEFFGACVQCCNSYLGTLDPGTLVFLGFSLAVLEYFPEDLLKK
MFNIEFLAR

FAST_1

FAST_1
PFAM accession number:PF06743
Interpro abstract (IPR010622):

This entry represents a conserved region of eukaryotic Fas-activated serine/threonine (FAST) kinases that contains several conserved leucine residues. FAST kinase is rapidly activated during Fas-mediated apoptosis, when it phosphorylates TIA-1, a nuclear RNA-binding protein that has been implicated as an effector of apoptosis [(PUBMED:7544399)]. Note that many family members are hypothetical proteins.

GO function:protein kinase activity (GO:0004672)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAST_1