The domain within your query sequence starts at position 117 and ends at position 249; the E-value for the FA_hydroxylase domain shown below is 2.5e-29.

WYFTFLGVDFGYYWFHRMAHEINIFWAAHQAHHSSEDYNLSTALRQSVLQQYSSWVFYCP
LALFIPPSVFAVHIQFNLLYQFWIHTEIIRTLGPLEVILNTPSHHRVHHGRNRYCIDKNY
AGTLIIWDRIFGT

FA_hydroxylase

FA_hydroxylase
PFAM accession number:PF04116
Interpro abstract (IPR006694):

This superfamily includes fatty acid and carotene hydroxylases and sterol desaturases. Beta-carotene hydroxylase is involved in zeaxanthin synthesis by hydroxylating beta-carotene, but the enzyme may be involved in other pathways [(PUBMED:8718622)]. This family includes C-5 sterol desaturase and C-4 sterol methyl oxidase. Members of this family are involved in cholesterol biosynthesis and biosynthesis a plant cuticular wax. These enzymes contain two copies of a HXHH motif. Members of this family are integral membrane proteins.

GO process:oxidation-reduction process (GO:0055114), lipid biosynthetic process (GO:0008610)
GO function:iron ion binding (GO:0005506), oxidoreductase activity (GO:0016491)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FA_hydroxylase