The domain within your query sequence starts at position 68 and ends at position 126; the E-value for the FBA domain shown below is 3.4e-18.

WKIFYFLRSLQRNLLHNPCAEEGFEFWSLDVNGGDEWKVEDLSKDQRKEFPNDQHLPQV

FBA

FBA
PFAM accession number:PF04300
Interpro abstract (IPR007397):

F-box proteins have a bipartite structure: they contain a carboxy-terminal domain that interacts with substrates and a 42-48 amino-acid F-box domain which binds to the protein Skp1. A subset of F-box proteins is characterized by a ~180-residue carboxy-terminal region, which has been called the F-box-associated (FBA) domain [ (PUBMED:10531037) (PUBMED:12383498) ]. A FBA domain has also been identified in the catfish, tilapia, and zebrafish nonspecific cytotoxic cell receptor proteins (NCCRP-1), which do not contain the F-box domain. NCCRP-1 may function as an antigen recognition molecule and, as such, may participate in innate immunity in teleosts [ (PUBMED:12383498) (PUBMED:11847564) ]. The FBA domain is likely to be a glycoprotein-binding module [ (PUBMED:12939278) (PUBMED:14990996) ].

This entry represents the FBA domain, which is an ellipsoid composed of a ten-stranded antiparallel beta- sandwich with two alpha-helices [ (PUBMED:14990996) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FBA