The domain within your query sequence starts at position 3 and ends at position 172; the E-value for the FCP1_C domain shown below is 3.8e-92.

CITLVVRAVQPHQQQMFGEELPESQDGEQPGPARRKRQPSMSEAMPLYTLCKEDLESMDK
EVDDILGEGSDDSDIEKKKPEDQDNEQERAPKPRKPRAPGIRREQPVGLPSSGERSTPGM
RGPRGHKRKLNEEDAASESSGESSNDDEEGSSSEADEMAAALEAELNDLM

FCP1_C

FCP1_C
PFAM accession number:PF09309
Interpro abstract (IPR015388):

The C-terminal domain of FCP-1 is required for interaction with the carboxy terminal domain of RAP74. Interaction relies extensively on van der Waals contacts between hydrophobic residues situated within alpha-helices in both domains [(PUBMED:12732728)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FCP1_C