The domain within your query sequence starts at position 3 and ends at position 172; the E-value for the FCP1_C domain shown below is 3.8e-92.

CITLVVRAVQPHQQQMFGEELPESQDGEQPGPARRKRQPSMSEAMPLYTLCKEDLESMDK
EVDDILGEGSDDSDIEKKKPEDQDNEQERAPKPRKPRAPGIRREQPVGLPSSGERSTPGM
RGPRGHKRKLNEEDAASESSGESSNDDEEGSSSEADEMAAALEAELNDLM

FCP1_C

• PFAM accession number: PF09309
• Interpro abstract (IPR015388):

  The C-terminal domain of FCP-1 is required for interaction with the carboxy terminal domain of RAP74. Interaction relies extensively on van der Waals contacts between hydrophobic residues situated within alpha-helices in both domains [ (PUBMED:12732728) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FCP1_C