The domain within your query sequence starts at position 230 and ends at position 287; the E-value for the FDF domain shown below is 7.5e-13.
MKFEKDFDFESANAQFNKEEIDREFHNKLKLKEDKLEKQEKPVNGEDKGDSGVDTQNS
FDF |
---|
PFAM accession number: | PF09532 |
---|---|
Interpro abstract (IPR019050): | The FDF domain, so called because of the conserved FDF at its N termini, is an entirely alpha-helical domain with multiple exposed hydrophilic loops [ (PUBMED:15257761) ]. It is found at the C terminus of Scd6p-like SM domains [ (PUBMED:15257761) (PUBMED:15225602) ]. It is also found with other divergent Sm domains and in proteins such as Dcp3p and FLJ21128, where it is found N-terminal to the YjeF-N domain, a novel Rossmann fold domain [ (PUBMED:15257761) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FDF