The domain within your query sequence starts at position 73 and ends at position 156; the E-value for the FERM_f0 domain shown below is 6.6e-17.

MVFRIGIPDLHQTKCLRFNPDATIWTAKQQVLCALSESLQDVLNYGLFQPATSGRDANFL
EEERLLREYPQSFEKGVPYLEFRY

FERM_f0

FERM_f0
PFAM accession number:PF16511
Interpro abstract (IPR032425):

This domain (F0), found in the talin head, forms a stable globular structure. The fold is an ubiquitin-like fold joined to the F1 domain in a novel fixed orientation by an extensive charged interface. It is required for maximal integrin-activation [(PUBMED:20150896)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FERM_f0