The domain within your query sequence starts at position 84 and ends at position 167; the E-value for the FERM_f0 domain shown below is 2.5e-14.
VVVRVGIPDLQQTKCLRLDPTAPVWAAKQRVLCALNHSLQDALNYGLFQPPSRGRAGKFL DEERLLQDYPPNLDTPLPYLEFRY
FERM_f0 |
![]() |
---|
PFAM accession number: | PF16511 |
---|---|
Interpro abstract (IPR032425): | This domain (F0), found in the talin head, forms a stable globular structure. The fold is an ubiquitin-like fold joined to the F1 domain in a novel fixed orientation by an extensive charged interface. It is required for maximal integrin-activation [ (PUBMED:20150896) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FERM_f0