The domain within your query sequence starts at position 58 and ends at position 167; the E-value for the FEZ domain shown below is 5.6e-38.

SMEDLVNEFDEKLNVCFRNYNAKTESLAPVKNQLQIQEEEETLRDEEVWDALTDNYIPSL
SEDWRDPNIEALNGNSSDIEIHEKEEEEFNEKSENDSGINEEPLLTADQV

FEZ

FEZ
PFAM accession number:PF07763
Interpro abstract (IPR011680):

The first member of the FEZ (fasciculation and elongation protein zeta) family identified was unc-76, from C. elegans. The protein is necessary for normal axon fasciculation and is required for axon-axon interactions [(PUBMED:9096408)]. Later, two human homologues, FEZ1 and FEZ2, were identified [(PUBMED:8401577)]. FEZ1 and FEZ2 interact with PKCzeta and have been shown to induce neurite extension of PC12 cells when co-expressed with a constitutively active mutant of PKCzeta [(PUBMED:14697253)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FEZ