The domain within your query sequence starts at position 1 and ends at position 52; the E-value for the FF domain shown below is 1.2e-7.

RREAAFRSMLRQAVPALELGTAWEEVRERFVCDSAFEQITLESERIRLFREF

FF

FF
PFAM accession number:PF01846
Interpro abstract (IPR002713):

The FF domain may be involved in protein-protein interaction [ (PUBMED:10390614) ]. It often occurs as multiple copies and often accompanies WW domains IPR001202 . PRP40 from yeast encodes a novel, essential splicing component that associates with the yeast U1 small nuclear ribonucleoprotein particle [ (PUBMED:8622699) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FF