The domain within your query sequence starts at position 25 and ends at position 60; the E-value for the FGF domain shown below is 2.7e-9.

KPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHTDTK

FGF

FGF
PFAM accession number:PF00167
Interpro abstract (IPR002209):

Fibroblast growth factors (FGFs) [(PUBMED:2549857), (PUBMED:3072709)] are a family of multifunctional proteins, often referred to as 'promiscuous growth factors' due to their diverse actions on multiple cell types [(PUBMED:1705486), (PUBMED:8760337)]. FGFs are mitogens, which stimulate growth or differentiation of cells of mesodermal or neuroectodermal origin. The function of FGFs in developmental processes include mesoderm induction, anterior-posterior patterning, limb development, and neural induction and development. In mature tissues, they are involved in diverse processes including keratinocyte organisation and wound healing [(PUBMED:11276432), (PUBMED:23000357), (PUBMED:15689573), (PUBMED:10441498), (PUBMED:23108135), (PUBMED:23016864)]. FGF involvement is critical during normal development of both vertebrates and invertebrates, and irregularities in their function leads to a range of developmental defects [(PUBMED:1649700), (PUBMED:11746231), (PUBMED:14745970), (PUBMED:8978613)]. Fibroblast growth factors are heparin-binding proteins and interactions with cell-surface-associated heparan sulfate proteoglycans have been shown to be essential for FGF signal transduction. FGFs have internal pseudo-threefold symmetry (beta-trefoil topology) [(PUBMED:10830168)]. There are currently over 20 different FGF family members that have been identified in mammals, all of which are structurally related signaling molecules [(PUBMED:8652550), (PUBMED:11276432)]. They exert their effects through four distinct membrane fibroblast growth factor receptors (FGFRs), FGFR1 to FGFR4 [(PUBMED:7583099)], which belong to the tyrosine kinase superfamily. Upon binding to FGF, the receptors dimerize and their intracellular tyrosine kinase domains become active [(PUBMED:7583099)].

GO function:growth factor activity (GO:0008083)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FGF