The domain within your query sequence starts at position 19 and ends at position 250; the E-value for the FGF-BP1 domain shown below is 9.6e-59.

TLLLLLGGCLLSAAGRDKGAAGREVTRASRPTVGSSGRFVSPEQHACSWQLLVPAPGTPT
GGELALRCQTPGGASLHCAYRGHPERCAATGARRAHYWRRLLGALRRRPRPCLDPAPLPP
RLCARKTAGSDLHSPAHPSLPARPSEPPRSRARSPARSRQSVRSPSSQPEKKPLLVKSNS
GGRKAGSDPVPEPPAAAGFQPNGLDQNAELTETYCTEKWHSLCNFFVNFWNG

FGF-BP1

FGF-BP1
PFAM accession number:PF06473
Interpro abstract (IPR010510):

This family consists of several mammalian FGF binding protein 1. Fibroblast growth factors (FGFs) play important roles during foetal and embryonic development [(PUBMED:11819092)]. Fibroblast growth factor-binding protein (FGF-BP) 1 is a secreted protein that can bind fibroblast growth factors (FGFs) 1 and 2 [(PUBMED:11509569)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FGF-BP1