The domain within your query sequence starts at position 1 and ends at position 131; the E-value for the FH2 domain shown below is 2e-33.

MGNAGSMDSQQTDFKAHNVPLKLPMPEPGELEERFAIVLNAMNLPPDKARLLRQYDNEKK
WELICDQERFQVKNPPHTYIQKLKGYLDPAVTRKKFRRRVQESTQVLRELEISLRTNHIG
WVREFLNEENK

FH2

FH2
PFAM accession number:PF02181
Interpro abstract (IPR015425):

Formin homology (FH) proteins play a crucial role in the reorganisation of the actin cytoskeleton, which mediates various functions of the cell cortex including motility, adhesion, and cytokinesis [(PUBMED:10631086)]. Formins are multidomain proteins that interact with diverse signalling molecules and cytoskeletal proteins, although some formins have been assigned functions within the nucleus. Formins are characterised by the presence of three FH domains (FH1, FH2 and FH3), although members of the formin family do not necessarily contain all three domains [(PUBMED:12538772)]. The proline-rich FH1 domain mediates interactions with a variety of proteins, including the actin-binding protein profilin, SH3 (Src homology 3) domain proteins, and WW domain proteins. The FH2 domain is required for the self-association of formin proteins through the ability of FH2 domains to directly bind each other [(PUBMED:14576350)], and may also act to inhibit actin polymerisation [(PUBMED:14992721)]. The FH3 domain (IPR010472) is less well conserved and may be important for determining intracellular localisation of formin family proteins. In addition, some formins can contain a GTPase-binding domain (GBD) (IPR010473) required for binding to Rho small GTPases, and a C-terminal conserved Dia-autoregulatory domain (DAD).

This entry represents the FH2 domain, which was shown by X-ray crystallography to have an elongated, crescent shape containing three helical subdomains [(PUBMED:15006353)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FH2