The domain within your query sequence starts at position 811 and ends at position 1065; the E-value for the FIIND domain shown below is 3.9e-136.

RVQLPMAGSYHCPSTRLHFVVTRAVTIEIEFCAWSQFLDKTPLQQSHMVVGPLFDIKAEQ
GAVTAVYLPHFVSLKDTKASTFDFKVAHFQEHGMVLETPDRVKPGYTVLKNPSFSPMGVV
LRIIPAARHFIPITSITLIYYRVNQEEVTLHLYLVPNDCTIQKAIDDEEMKFQFVRINKP
PPVDNLFIGSRYIVSGSENLEITPKELELCYRSSKEFQLFSEIYVGNMGSEIKLQIKNKK
HMKLIWEALLKPGDL

FIIND

FIIND
PFAM accession number:PF13553
Interpro abstract (IPR025307):

The function to find (FIIND) domain was initially discovered in two proteins, NLRP1 (aka NALP1, CARD7, NAC, DEFCAP) and CARD8 (aka TUCAN, Cardinal) [(PUBMED:11408476)]. NLRP1 is a member of the Nod-like receptor (NLR) protein superfamily and is involved in apoptosis and inflammation. To date, it is the only NLR protein known to have a FIIND domain. The FIIND domain is also present in the CARD8 protein where, like in NLRP1, it is followed by a C-terminal CARD domain. Both proteins are described to form an "inflammasome", a macro-molecular complex able to process caspase 1 and activate pro-IL1beta [(PUBMED:12563287)]. The FIIND domain is present in only a very small subset of the kingdom of life, comprising primates, rodents (mouse, rat), carnivores (dog) and a few more, such as horse. The function of this domain is yet to be determined. Publications describing the newly discovered NLRP1 protein failed to identify it as a separate domain; for example, it was taken as part of the adjacent leucine rich repeat domain (LRR) [(PUBMED:11076957)]. Upon discovery of CARD8 it was noted that the N-terminal region shared significant sequence identity with an undescribed region in NLRP1 [(PUBMED:11408476)]. Before getting its final name, FIIND [(PUBMED:12563287)], this domain was termed NALP1-associated domain (NAD) [(PUBMED:12191486)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FIIND