The domain within your query sequence starts at position 135 and ends at position 173; the E-value for the FISNA domain shown below is 1.6e-12.

MYRRHVRSRFYSIKDRNARLGESVDLNSRYTQLQLVKEH

FISNA

FISNA
PFAM accession number:PF14484
Interpro abstract (IPR029495):

This domain is frequently found associated with the NACHT domain (IPR007111) in fish and other vertebrates [(PUBMED:18039395)]. Proteins containing this domain include NACHT, LRR and PYD domains-containing protein 3/12 (NLRP3/12). In humans, NLRP3 (also known as PYPAF1) may function as an inducer of apoptosis [(PUBMED:11786556)]. NLRP12 is a non-inflammasome NLR (nucleotide-binding domain and leucine-rich repeat-containing receptors) that has been implicated in the regulation of Toll-like receptor-dependent nuclear factor-kappaB activation [(PUBMED:21978668)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FISNA