SMART: Pfam domain FISNA

The domain within your query sequence starts at position 135 and ends at position 173; the E-value for the FISNA domain shown below is 1.6e-12.

MYRRHVRSRFYSIKDRNARLGESVDLNSRYTQLQLVKEH

FISNA

PFAM accession number:	PF14484
Interpro abstract (IPR029495):	This domain is frequently found associated with the NACHT domain ( IPR007111 ) in fish and other vertebrates [ (PUBMED:18039395) ]. Proteins containing this domain include NACHT, LRR and PYD domains-containing protein 3/12 (NLRP3/12). In humans, NLRP3 (also known as PYPAF1) may function as an inducer of apoptosis [ (PUBMED:11786556) ]. NLRP12 is a non-inflammasome NLR (nucleotide-binding domain and leucine-rich repeat-containing receptors) that has been implicated in the regulation of Toll-like receptor-dependent nuclear factor-kappaB activation [ (PUBMED:21978668) ].

PFAM accession number:

PF14484

Interpro abstract (IPR029495):

This domain is frequently found associated with the NACHT domain ( IPR007111 ) in fish and other vertebrates [ (PUBMED:18039395) ]. Proteins containing this domain include NACHT, LRR and PYD domains-containing protein 3/12 (NLRP3/12). In humans, NLRP3 (also known as PYPAF1) may function as an inducer of apoptosis [ (PUBMED:11786556) ]. NLRP12 is a non-inflammasome NLR (nucleotide-binding domain and leucine-rich repeat-containing receptors) that has been implicated in the regulation of Toll-like receptor-dependent nuclear factor-kappaB activation [ (PUBMED:21978668) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FISNA