SMART: Pfam domain FKBP

The domain within your query sequence starts at position 157 and ends at position 251; the E-value for the FKBP_C domain shown below is 5e-23.

PSCPRTIQVSDFVRYHYNGTFLDGTLFDSSHNRMKTYDTYVGIGWLIPGMDKGLLGMCVG
EKRIITVPPFLAYGEEGDGKDIPGQASLVFDVALL

FKBP_C

PFAM accession number:	PF00254
Interpro abstract (IPR001179):	Synonym(s): Peptidylprolyl cis-trans isomerase FKBP-type peptidylprolyl isomerases (EC 5.2.1.8) in vertebrates, are receptors for the two immunosuppressants, FK506 and rapamycin. The drugs inhibit T cell proliferation by arresting two distinct cytoplasmic signal transmission pathways. Peptidylprolyl isomerases accelerate protein folding by catalysing the cis-trans isomerisation of proline imidic peptide bonds in oligopeptides. These proteins are found in a variety of organisms.
GO process:	protein folding (GO:0006457)

PFAM accession number:

PF00254

Interpro abstract (IPR001179):

Synonym(s): Peptidylprolyl cis-trans isomerase

FKBP-type peptidylprolyl isomerases (EC 5.2.1.8) in vertebrates, are receptors for the two immunosuppressants, FK506 and rapamycin. The drugs inhibit T cell proliferation by arresting two distinct cytoplasmic signal transmission pathways. Peptidylprolyl isomerases accelerate protein folding by catalysing the cis-trans isomerisation of proline imidic peptide bonds in oligopeptides. These proteins are found in a variety of organisms.

GO process:

protein folding (GO:0006457)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FKBP_C