The domain within your query sequence starts at position 4 and ends at position 159; the E-value for the FMN_red domain shown below is 5.6e-15.

KKVLIVYAHQEPKSFNGSLKKVAVEELSKQGCTVTVSDLYSMNFEPRATRNDITGAPSNP
DVFSYGIETHEAYKKKALTSDIFEEQRKVQEADLVIFQFPLYWFSVPAILKGWMDRVLCR
GFAFDIPGFYDSGFLKGKLALLSLTTGGTAEMYTKD

FMN_red

FMN_red
PFAM accession number:PF03358
Interpro abstract (IPR005025):

This domain in found in several flavoproteins such as FMN-dependent NADPH-azoreductase, which catalyses the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines [(PUBMED:16752898)], and NAD(P)H:quinone oxidoreductase, which reduces quinones to the hydroquinone state to prevent interaction of the semiquinone with O2 and production of superoxide [(PUBMED:9694845)]. In Arabidopsis NADPH:quinone oxidoreductase is involved in detoxification pathways [(PUBMED:10606758)]. NAD(P)H:quinone oxidoreductase prefers NADH over NADPH, while FMN-dependent NADPH-azoreductase requires NADPH, but not NADH, as an electron donor for its activity.

Other proteins with this domain include iron-sulfur flavoproteins [(PUBMED:11591665)] and chromate reductase [(PUBMED:14766567)].

GO function:oxidoreductase activity (GO:0016491)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FMN_red