The domain within your query sequence starts at position 4 and ends at position 174; the E-value for the FMN_red domain shown below is 6e-11.

RRALIVLAHSEKTSFNYAMKEAAVEALKKRGWEVLESDLYAMNFNPIISRNDITGELKDS
KNFQYPSESSLAYKEGRLSPDIVAEHKKLEAADLVIFQFPLQWFGVPAILKGWFERVLVA
GFAYTYAAMYDNGPFQNKKTLLSITTGGSGSMYSLQGVHGDMNVILWPIQS

FMN_red

FMN_red
PFAM accession number:PF03358
Interpro abstract (IPR005025):

This domain in found in several flavoproteins such as FMN-dependent NADPH-azoreductase, which catalyses the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines [ (PUBMED:16752898) ], and NAD(P)H:quinone oxidoreductase, which reduces quinones to the hydroquinone state to prevent interaction of the semiquinone with O2 and production of superoxide [ (PUBMED:9694845) ]. In Arabidopsis NADPH:quinone oxidoreductase is involved in detoxification pathways [ (PUBMED:10606758) ]. NAD(P)H:quinone oxidoreductase prefers NADH over NADPH, while FMN-dependent NADPH-azoreductase requires NADPH, but not NADH, as an electron donor for its activity.

Other proteins with this domain include iron-sulfur flavoproteins [ (PUBMED:11591665) ] and chromate reductase [ (PUBMED:14766567) ].

GO function:oxidoreductase activity (GO:0016491)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FMN_red