The domain within your query sequence starts at position 1 and ends at position 484; the E-value for the FMO-like domain shown below is 1.6e-222.

MPSIYRSVTINTSKEMMCFSDFPIPDHFPNYMHNSKLMDYFRMYAKRFSLLDYIRFKTTV
RSVRKRPDFHIHGQWDVVVETDGKQESLVFDGVLVCSGHHTDPHLPLKSFPGIEKFEGCY
FHSREYKSPEDYVGKRIIVVGIGNSGVDIAVELGRVAKQVFLSTRRGSWILHRVWNNGYP
MDSSFFTRFHSFLQKILTTEAVNKYLEKTLNSRFNHAHYGLQPQHRPLSQHPTISDDLPN
HIISGKVQVKPNVKEFTGTDVHFDDGTVEENIDVVIFATGYSISFPFLGDLIAVTDNEVS
LYKLMFPPDLEKPTLAVIGLIQPLGIILPIAELQSRWAVRVFKGLSKLPSVKAMKADMDQ
RKKAMEKRYVKTARHTIQVDHIEYMDEIASLAGVKPNLLLLFLSDPTLAMEVFFGPCTPY
QYRLQGPGKWDGARRAILTQRERIIKPLKTRITSEKSRSAPGLFWIKMALFGLAFLVPSL
TYFS

FMO-like

FMO-like
PFAM accession number:PF00743
Interpro abstract (IPR020946):

Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [ (PUBMED:8311461) ]. Using an NADPH cofactor and FAD prosthetic group, these microsomal proteins catalyse the oxygenation of nucleophilic nitrogen, sulphur, phosphorus and selenium atoms in a range of structurally diverse compounds. FMOs have been implicated in the metabolism of a number of pharmaceuticals, pesticides and toxicants. In man, lack of hepatic FMO-catalysed trimethylamine metabolism results in trimethylaminuria (fish odour syndrome). Five mammalian forms of FMO are now known and have been designated FMO1-FMO5 [ (PUBMED:1712018) (PUBMED:2318837) (PUBMED:1542660) (PUBMED:1417778) (PUBMED:8486656) ]. This is a recent nomenclature based on comparison of amino acid sequences, and has been introduced in an attempt to eliminate confusion inherent in multiple, laboratory-specific designations and tissue-based classifications [ (PUBMED:8311461) ]. Following the determination of the complete nucleotide sequence of Saccharomyces cerevisiae (Baker's yeast) [ (PUBMED:8091229) ], a novel gene was found to encode a protein with similarity to mammalian monooygenases. In Aspergillus, flavin-containing monooxygenases ustF1 and ustF2 are components in the biosynthesis of the antimitotic tetrapeptide ustiloxin B, a secondary metabolite. The monooxygenases modify the side chain of the intermediate S-deoxyustiloxin H [ (PUBMED:27166860) ].

GO process:oxidation-reduction process (GO:0055114)
GO function:flavin adenine dinucleotide binding (GO:0050660), NADP binding (GO:0050661), N,N-dimethylaniline monooxygenase activity (GO:0004499)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FMO-like