The domain within your query sequence starts at position 288 and ends at position 526; the E-value for the FNIP_M domain shown below is 5.1e-87.

NLSDESCGPNPGIVRKKKIAIGVIFSLSKDEDENNKFNEFFFSHFPLFESHMNKLKSAIE
QAMKMSRRSADASQRSLAYNRILDALTEFRTTICNLYTMPRIGEPVWLTMMSGTPEKNQL
CHRFMKEFTFLMENASKNQFLPALITAVLTNHLAWVPTVMPNGQPPIKIFLEKHSSQSVG
MLAKTHPYNPLWAQLGDLYGAIGSPVRLARTVVVGKRQDLVQRLLYFLTYFIRCSELQE

FNIP_M

FNIP_M
PFAM accession number:PF14637
Interpro abstract (IPR028085):

This is the middle domain of folliculin-interacting proteins [(PUBMED:18663353), (PUBMED:18403135)], which may have a role in energy and/or nutrient sensing.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FNIP_M