The domain within your query sequence starts at position 41 and ends at position 159; the E-value for the FNIP_N domain shown below is 1.7e-29.

QIRLIVYQDCERRGRNVLFDSSVKRKNEDTSVSKLCNDAQVKVFGKCCQLKPGGDSSSSL
DSSITLSSDGKDQCPKYQGSRCSSDANMLGEMMFGSVAMSYKGSTLKIHQIRSPPQLML

FNIP_N

FNIP_N
PFAM accession number:PF14636
Interpro abstract (IPR028084):

This domain is found at the N terminus of folliculin-interacting proteins [(PUBMED:18663353), (PUBMED:18403135)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FNIP_N