The domain within your query sequence starts at position 431 and ends at position 510; the E-value for the FOXO_KIX_bdg domain shown below is 5.5e-36.

STVFGPSSLNSLRQSPMQTIQENRPATFSSVSHYGNQTLQDLLASDSLSHSDVMMTQSDP
LMSQASTAVSAQNARRNVML

FOXO_KIX_bdg

FOXO_KIX_bdg
PFAM accession number:PF16675
Interpro abstract (IPR032068):

This entry represents a domain found in the transcription factor forkhead box O (FOXO) that binds to the KIX domain of CREB-binding proteins. Coactivator CBP/p300 is recruited by FOXO3 via the binding of this domain as well as the simultaneous binding of the C-terminal TAD domain [(PUBMED:22474372)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FOXO_KIX_bdg