The domain within your query sequence starts at position 51 and ends at position 199; the E-value for the FPL domain shown below is 9.2e-61.

IRSITEILIWGDQNDSSVFDFFLEKNMFVFFLNILRQKSGRYVCVQLLQTLNILFENISH
ETSLYYLLSNNYVNSIIVHKFDFSDEEIMAYYISFLKTLSLKLNNHTVHFFYNEHTNDFA
LYTEAIKFFNHPESMVRIAVRTITLNVYK

FPL

FPL
PFAM accession number:PF09758
Interpro abstract (IPR019155):

CLEC16A (C-Type Lectin Domain Containing 16A) has an inhibitory role in autophagy, probably by activating the mTOR pathway [(PUBMED:28223137)]. It also has a role in beta-cells as a regulator of mitophagy [(PUBMED:24949970)].

GFS9/TT9 (TRANSPARENT TESTA 9) is a protein from Arabidopsis required for vacuolar development through membrane fusion at vacuoles. It contributes to intracellular membrane trafficking and flavonoid accumulation [(PUBMED:25116949)].

This entry represents a domain found at the N terminus of CLEC16A and GFS9/TT9.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FPL