The domain within your query sequence starts at position 22 and ends at position 70; the E-value for the FPN1 domain shown below is 4.9e-19.
TSAKFLLYLGHSLSTWGDRMWHFAVSVFLVELYGNSLLLTAVYGLVVAG
FPN1 |
 |
|---|
| PFAM accession number: | PF06963 |
|---|---|
| Interpro abstract (IPR009716): | This entry represents the solute carrier family 40 member 1 family of proteins, also known as Ferroportin 1. It is thought to be involved in iron export from duodenal epithelial cells and also in transfer of iron between maternal and fetal circulation. This family of proteins is known to be localised in the basolateral membrane of polarized epithelial cells [ (PUBMED:10882071) ]. |
| GO process: | iron ion transmembrane transport (GO:0034755) |
| GO component: | integral component of membrane (GO:0016021) |
| GO function: | iron ion transmembrane transporter activity (GO:0005381) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FPN1