The domain within your query sequence starts at position 56 and ends at position 137; the E-value for the FR47 domain shown below is 1.1e-9.
VLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFGAKYVSLHVRKSN RAALHLYSNTLNFQVSEVEPKY
FR47 |
![]() |
---|
PFAM accession number: | PF08445 |
---|---|
Interpro abstract (IPR013653): | Proteins in this entry have a conserved region similar to the C-terminal region of the Drosophila melanogaster (Fruit fly) hypothetical protein FR47 ( Q9VR51 ). This protein has been found to consist of two N-acyltransferase-like domains swapped with the C-terminal strands. |
GO function: | transferase activity, transferring acyl groups other than amino-acyl groups (GO:0016747) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FR47