SMART: Pfam domain FRG2

The domain within your query sequence starts at position 75 and ends at position 190; the E-value for the FRG2 domain shown below is 4.8e-35.

RIGNEGSLHGKKRHKTSVKKTEPKANGHQDGLAHCPEPQDTDPPPIRKSLVSFLRGKSEE
IYRDTVQMQAQKLGSLLTPEQLSQLRQLSESLTAMVYSLLQHGQPGGFAFPAEGWL

FRG2

PFAM accession number:	PF15315
Interpro abstract (IPR026245):	FRG2, a member of a chromosomally dispersed gene family, has been identified and characterised [ (PUBMED:15520407) ]. Low levels of FRG2 expression were detectable in differentiating myoblasts of autosomal dominant facioscapulohumeral muscular dystrophy (FSHD) patients, partly from chromosome 4, but originating largely from its homologue on chromosome 10 [ (PUBMED:15520407) ]. In non-FSHD myopathy patients, only distantly-related FRG2 homologues are transcribed, while differentiating myoblasts from healthy controls do not express any member of this gene family [ (PUBMED:15520407) ]. The localisation of FRG2 genes close to the D4Z4 repeats on chromosomes 4 and 10, their transcriptional up-regulation in FSHD myoblast cultures, potential involvement in myogenesis, and promoter properties, render FRG2 an attractive candidate for FSHD pathogenesis. Nevertheless, sequence- and motif-based searches have shed no light on the function of the predicted protein [ (PUBMED:15520407) ].

PFAM accession number:

PF15315

Interpro abstract (IPR026245):

FRG2, a member of a chromosomally dispersed gene family, has been identified and characterised [ (PUBMED:15520407) ]. Low levels of FRG2 expression were detectable in differentiating myoblasts of autosomal dominant facioscapulohumeral muscular dystrophy (FSHD) patients, partly from chromosome 4, but originating largely from its homologue on chromosome 10 [ (PUBMED:15520407) ]. In non-FSHD myopathy patients, only distantly-related FRG2 homologues are transcribed, while differentiating myoblasts from healthy controls do not express any member of this gene family [ (PUBMED:15520407) ]. The localisation of FRG2 genes close to the D4Z4 repeats on chromosomes 4 and 10, their transcriptional up-regulation in FSHD myoblast cultures, potential involvement in myogenesis, and promoter properties, render FRG2 an attractive candidate for FSHD pathogenesis. Nevertheless, sequence- and motif-based searches have shed no light on the function of the predicted protein [ (PUBMED:15520407) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FRG2