The domain within your query sequence starts at position 193 and ends at position 364; the E-value for the FSH1 domain shown below is 3.5e-5.

FEDLPKELNVIEVDYFEEAVRYMLRHPKVKGPDIGLLGLSLGADVCLIMASFLNNVSATV
SINGSAFSGNRHIKYKQTMIPPLGHDLRRMKVAFSGILDIVDIRNDAVGGCENPSMIPIE
KAKGPILFVAGQDDHCWRSELYTQIASDRLQAHGKERPQVLSYPGTGHYIEP

FSH1

FSH1
PFAM accession number:PF03959
Interpro abstract (IPR005645): This domain can be found in budding yeast Fsh1/2/3, fission yeast Dfr1 and the human OVCA2 protein. Fsh1/2/3 are putative serine hydrolases [(PUBMED:14645503)]. Dfr1 is a dihydrofolate reductase (DHFR) [(PUBMED:8088538)]. OVCA2 is a putative serine-hydrolase that has been linked to cancers [(PUBMED:16368187)]. Proteins containing this domain also includes Aspergillus terreus esterase LovG, which catalyzes the release of covalently bound dihydromonacolin L from LovB during lovastatin biosynthesis [(PUBMED:23653178)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FSH1