The domain within your query sequence starts at position 77 and ends at position 214; the E-value for the FSH1 domain shown below is 1.7e-7.
DFFVGQEPWDPAGDWSTFPAWLKSRNARKVNREVDAVLRYLRQQCHAQKIGIVGFCWGGV VVHQVMTAYPDIRAGVSVYGIIRDSEDVYNLKNPTLFIFAENDTVIPLEQVSTLTQKLKE HCIVNYQVKTFSGQTHGF
FSH1 |
---|
PFAM accession number: | PF03959 |
---|---|
Interpro abstract (IPR005645): | This domain can be found in budding yeast Fsh1/2/3, fission yeast Dfr1 and the human OVCA2 protein. Fsh1/2/3 are putative serine hydrolases [ (PUBMED:14645503) ]. Dfr1 is a dihydrofolate reductase (DHFR) [ (PUBMED:8088538) ]. OVCA2 is a putative serine-hydrolase that has been linked to cancers [ (PUBMED:16368187) ]. Proteins containing this domain also includes Aspergillus terreus esterase LovG, which catalyzes the release of covalently bound dihydromonacolin L from LovB during lovastatin biosynthesis [ (PUBMED:23653178) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FSH1