The domain within your query sequence starts at position 81 and ends at position 183; the E-value for the FUN14 domain shown below is 2.9e-35.

QLLIGGVTGWCTGFIFQKVGKLAATAVGGGFFLLQLANHTGYIKVDWSRVEKDMKKAKEQ
LTIRKSAQIPTEVKSKAEEVVCFVKKNVLVTGGFFGGFLLGMA

FUN14

FUN14
PFAM accession number:PF04930
Interpro abstract (IPR007014):

This is a family of short proteins found in eukaryotes and some archaea. In humans, FUN14 domain-containing protein 1 (FUND1) acts as an activator of hypoxia-induced mitophagy, an important mechanism for mitochondrial quality control [(PUBMED:22267086)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FUN14