The domain within your query sequence starts at position 489 and ends at position 564; the E-value for the FXR_C1 domain shown below is 1.9e-41.

GGKSSISSVLKDPDSNPYSLLDNTESDQTADTDASESHHSTNRRRRSRRRRTDEDAVLMD
GLTESDTASVNENGLD

FXR_C1

FXR_C1
PFAM accession number:PF16096
Interpro abstract (IPR032172):

This is a small highly conserved region of the C terminus of Fragile X-related proteins 1 and 2, FRX1, FRX2. The domain is immediately C-terminal to the core C- terminal region, IPR022034, and contains at least one block of RGG repeats that bind to G-quartet sequences in a wide variety of mRNAs [(PUBMED:20463240)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FXR_C1