The domain within your query sequence starts at position 44 and ends at position 158; the E-value for the FYVE_2 domain shown below is 1e-38.
EELTDEEKEIINRVIARAEKMEAMEQERIGRLVDRLETMRKNVAGDGVNRCILCGEQLGM LGSACVVCEDCKKNVCTKCGVETSNNRPHPVWLCKICLEQREVWKRSGAWFFKGF
FYVE_2 |
---|
PFAM accession number: | PF02318 |
---|---|
Interpro abstract (IPR041282): | This FYVE-type zinc finger is found at the N terminus of effector proteins including rabphilin-3A [ (PUBMED:10025402) ] and regulating synaptic membrane exocytosis protein 2 [ (PUBMED:16732694) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FYVE_2