The domain within your query sequence starts at position 76 and ends at position 194; the E-value for the FYVE_2 domain shown below is 2.2e-11.

GITELVNNVLQPQQKQPNEKEPQTKLHQQFEMYKEQVKKMGEESQQQQEQKGDAPTCGIC
HKTKFADGCGHNCSYCQTKFCARCGGRVSLRSNKVMWVCNLCRKQQEILTKSGAWFYNS

FYVE_2

FYVE_2
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FYVE_2