The domain within your query sequence starts at position 143 and ends at position 188; the E-value for the F_actin_cap_B domain shown below is 4.2e-13.
ECVVMSTGLSDSLPERYFEGGVSSVYLWDLDHGFAGVILIKKAGDG
F_actin_cap_B |
![]() |
---|
PFAM accession number: | PF01115 |
---|---|
Interpro abstract (IPR001698): | The F-actin capping protein binds in a calcium-independent manner to the fast growing ends of actin filaments (barbed end) and thereby restricts its growth. The F-actin capping protein is a heterodimer composed of two unrelated subunits: alpha and beta. Neither of the subunits shows sequence similarity to other filament-capping proteins [(PUBMED:2341404)]. This entry represents the beta subunit (CAPZB), which is a protein of about 280 amino acid residues whose sequence is well conserved in eukaryotic species [(PUBMED:2179733)]. In Drosophila mutations in the alpha and beta subunits cause actin accumulation and subsequent retinal degeneration [(PUBMED:16143599)]. In humans CAPZB is part of the WASH complex that controls the fission of endosomes [(PUBMED:19922875)]. |
GO process: | barbed-end actin filament capping (GO:0051016) |
GO component: | F-actin capping protein complex (GO:0008290) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry F_actin_cap_B