The domain within your query sequence starts at position 6 and ends at position 110; the E-value for the F_actin_cap_B domain shown below is 2.2e-53.

LDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYN
RDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRD

F_actin_cap_B

F_actin_cap_B
PFAM accession number:PF01115
Interpro abstract (IPR001698):

The F-actin capping protein binds in a calcium-independent manner to the fast growing ends of actin filaments (barbed end) and thereby restricts its growth. The F-actin capping protein is a heterodimer composed of two unrelated subunits: alpha and beta. Neither of the subunits shows sequence similarity to other filament-capping proteins [ (PUBMED:2341404) ].

This entry represents the beta subunit (CAPZB), which is a protein of about 280 amino acid residues whose sequence is well conserved in eukaryotic species [ (PUBMED:2179733) ]. In Drosophila mutations in the alpha and beta subunits cause actin accumulation and subsequent retinal degeneration [ (PUBMED:16143599) ]. In humans CAPZB is part of the WASH complex that controls the fission of endosomes [ (PUBMED:19922875) ].

GO process:barbed-end actin filament capping (GO:0051016)
GO component:F-actin capping protein complex (GO:0008290)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry F_actin_cap_B