The domain within your query sequence starts at position 188 and ends at position 399; the E-value for the Fam20C domain shown below is 3.1e-89.

FLTVGNNTCFYGKCYYCRETEPACADGDMMEGSVTLWLPDVWPLQKHRHPWGRTYREGKL
ARWEYDESYCDAVKKTSPYDSGPRLLDIIDTAVFDYLIGNADRHHYESFQDDEGASMLIL
LDNAKSFGNPSLDERSILAPLYQCCIIRVSTWNRLNYLKNGVLKSALKSAMAHDPISPVL
SDPHLDTVDQRLLNVLATIKQCTDQFGTDTVL

Fam20C

Fam20C
PFAM accession number:PF06702
Interpro abstract (IPR009581):

This entry represents the C-terminal of the eukaryotic secreted Golgi casein kinase protein FAM20C. FAM20C is the Golgi casein kinase that phosphorylates secretory pathway proteins within Ser-x-Glu/pSer motifs. Mutations in the FAM20C gene cause Raine syndrome, an autosomal recessive osteosclerotic bone dysplasia [(PUBMED:23754375)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Fam20C