The domain within your query sequence starts at position 1 and ends at position 246; the E-value for the FancD2 domain shown below is 5.7e-116.

XLLRNKIQSDCIQEQLLDSAFSTHYLVLKDICPSILLLAQTLFHSQDQRIILFGSLLYKY
AFKFFDTYCQQEVVGALVTHVCSGTEAEVDTALDVLLELIVLNASAMRLNAAFVKGILDY
LENMSPQQIRKIFCILSTLAFSQQPGTSNHIQSLCSHLIIALQDDMHLVIRKQLSSTVFK
YKLIGIIGAVTMAGIMAEDRSVPSNSSQRSANVSSEQRTQVTSLLQLVHSCTEHSPWASS
LYYDEF

FancD2

FancD2
PFAM accession number:PF14631
Interpro abstract (IPR029448):

The Fanconi Anemia (FA) pathway is responsible for interstrand crosslink DNA repair [(PUBMED:23444773)]. The name originates the recessive syndrome known as Fanconi anemia, which causes developmental problems and cancer predisposition [(PUBMED:11530803)]. In this pathway, the FANCI-FANCD2 (ID) complex is ubiquitinated by the FA core complex and then travels to sites of damage to coordinate repair [(PUBMED:20603016), (PUBMED:20603015)]. FA pathway activation seems to trigger dissociation of FANCD2 from FANCI, coinciding with FANCD2 monoubiquitination which precedes monoubiquitination of FANCI [(PUBMED:22753026)]. This suggests a functional separation for FANCD2 from FANCI [(PUBMED:23658231)].

Monoubiquitinated FANCD2 functions to recruit DNA repair factors FAN1 (Fanconi-associated nuclease 1) [(PUBMED:20603073)] and SLX4 [(PUBMED:21464321)], suggesting that chromatin-bound FANCD2Ub is a docking platform for certain DNA repair nucleases. FANCD2 has also a role in replication fork recovery [(PUBMED:24556218)].

GO process:DNA repair (GO:0006281)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FancD2