The domain within your query sequence starts at position 1246 and ends at position 1308; the E-value for the Fanconi_A domain shown below is 8.4e-36.

EELLIALFFFSLMGLLSSYLTQRDTAEHLKAVDICAEVLTCLERRKVSWLVLFQLTEKDA
KLG

Fanconi_A

Fanconi_A
PFAM accession number:PF03511
Interpro abstract (IPR003516): Fanconi anaemia (FA) [(PUBMED:1641028), (PUBMED:8490620), (PUBMED:7929819)] is a recessive inherited disease characterised by defective DNA repair. FA cells are sensitive to DNA cross-linking agents that cause chromosomal instability and cell death. The disease is manifested clinically by progressive pancytopenia, variable physical anomalies, and predisposition to malignancy [(PUBMED:7929819)]. Four complementation groups have been identified, designated A to D. The FA group A gene (FAA, FACA, FANCA) has been cloned [(PUBMED:9169126)], but its function remains to be elucidated.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Fanconi_A