The domain within your query sequence starts at position 1 and ends at position 199; the E-value for the Fanconi_C domain shown below is 1.8e-117.
MPTDSFCCCEGTVLLSEMAQESADLASDCQSWLQKLSAWEQASSEETQKDTCLHLSGFQE FLRQMYEILKEMDSDAILERFPTIGQLLAKACWNPLILAYDESQKIVIWCLCCLMNKEPR TSAESGLNSWIRGLLSHVLSAFRFDMKEVCLFTKSLGYESIDYYPSLLKNMVLSLVSELR ESHLNGLSTQSRMAPERMM
Fanconi_C |
---|
PFAM accession number: | PF02106 |
---|---|
Interpro abstract (IPR000686): | This entry represents FANCC [ (PUBMED:29017571) ]. Fanconi anemia (FA) is a human disorder characterized by cancer susceptibility and cellular sensitivity to DNA crosslinks and other damages. The FA complex repairs the interstrand cross-linking (ICL) lesions and coordinates activities of the downstream DNA repair pathway including nucleotide excision repair, translesion synthesis, and homologous recombination. It is required for the monoubiquitylation of FANCD2 and FANCI heterodimer. The FA core complex consists of FANCA, FANCB, FANCC, FANCE, FANCF, FANCG, FANCL, FANCM, FANCT (UBET2), FAAP100 and FAAP24 [ (PUBMED:29017571) (PUBMED:20347428) ]. |
GO process: | interstrand cross-link repair (GO:0036297) |
GO component: | Fanconi anaemia nuclear complex (GO:0043240) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Fanconi_C