The domain within your query sequence starts at position 12 and ends at position 219; the E-value for the Far-17a_AIG1 domain shown below is 5.4e-74.

AILLSYCSILCNYKAIEMPSHQTYGGSWKFLTFIDLVIQAVFFGICVLTDLSSLLTRGSG
NQEQERQLRKLISLRDWTLAVLAFPVGVFVVAVFWTIYAYDREMIYPRLLDNFIPGWLNH
GMHTTVLPFILIEMRTSHHQYPSRSSGLAAICTFSVGYILWVCWIHHVTGMWVYPFLEHI
GSGARIIFFGSTTILMNFLYLLGEVLNS

Far-17a_AIG1

Far-17a_AIG1
PFAM accession number:PF04750
Interpro abstract (IPR006838):

This family includes the hamster androgen-induced FAR-17a protein [(PUBMED:2045681)], and its human homologue, the AIG1 protein [(PUBMED:11266118)]. The function of these proteins is unknown. This family also includes homologous regions from a number of other metazoan proteins.

GO component:integral component of membrane (GO:0016021)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Far-17a_AIG1