SMART: Pfam domain Fcf1

The domain within your query sequence starts at position 1 and ends at position 44; the E-value for the Fcf1 domain shown below is 4.7e-12.

MVDEGNPHHYFVATQDQNLSVKVKRTPGIPLMFIIQNTIVLDKP

Fcf1

PFAM accession number:	PF04900
Interpro abstract (IPR006984):	Utp23 share homology with PINc domain protein Fcf1. They are components of the small subunit processome (SSU) that are involved in rRNA-processing and ribosome biogenesis [ (PUBMED:16762320) (PUBMED:16769905) ]. Depletion of yeast Fcf1 and Fcf2 leads to a decrease in synthesis of the 18S rRNA and results in a deficit in 40S ribosomal subunits [ (PUBMED:16762320) ].
GO component:	small-subunit processome (GO:0032040)

PFAM accession number:

PF04900

Interpro abstract (IPR006984):

Utp23 share homology with PINc domain protein Fcf1. They are components of the small subunit processome (SSU) that are involved in rRNA-processing and ribosome biogenesis [ (PUBMED:16762320) (PUBMED:16769905) ].

Depletion of yeast Fcf1 and Fcf2 leads to a decrease in synthesis of the 18S rRNA and results in a deficit in 40S ribosomal subunits [ (PUBMED:16762320) ].

GO component:

small-subunit processome (GO:0032040)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Fcf1