The domain within your query sequence starts at position 51 and ends at position 149; the E-value for the Fcf1 domain shown below is 2.5e-32.

RYLMGETQLCTTRCVLKELETLGKELYGAKLIAQKCQVRNCPHFKSPVSGSECLLSMVDE
GNPHHYFVATQDQNLSVKVKRTPGIPLMFIIQNTIVLDK

Fcf1

Fcf1
PFAM accession number:PF04900
Interpro abstract (IPR006984):

Utp23 share homology with PINc domain protein Fcf1. They are components of the small subunit processome (SSU) that are involved in rRNA-processing and ribosome biogenesis [(PUBMED:16762320), (PUBMED:16769905)].

Depletion of yeast Fcf1 and Fcf2 leads to a decrease in synthesis of the 18S rRNA and results in a deficit in 40S ribosomal subunits [(PUBMED:16762320)].

GO component:small-subunit processome (GO:0032040)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Fcf1