The domain within your query sequence starts at position 639 and ends at position 733; the E-value for the Fcf2 domain shown below is 3.4e-41.

RQKTAGNGWFGMKAPELTDELKNDLRALKMRAGMDPKRFYKKNDRDGFPKYFQVGTIVDN
PADFYHSRIPKKQRKKTIVEELLADSEFRRFNRRK

Fcf2

Fcf2
PFAM accession number:PF08698
Interpro abstract (IPR014810):

This domain is found in eukaryotic nucleolar proteins that are involved in pre-rRNA processing [(PUBMED:16762320)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Fcf2