The domain within your query sequence starts at position 23 and ends at position 125; the E-value for the Fe-S_biosyn domain shown below is 7.4e-23.
AALTLTPSAVNKIKQLLKDKPEHVGLKVGVRTRGCNGLSYSLEYTKTKGDSDEEVIQDGV RVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGE
Fe-S_biosyn |
---|
PFAM accession number: | PF01521 |
---|---|
Interpro abstract (IPR000361): | The proteins in this entry are variously annotated as iron-sulphur cluster insertion protein or Fe/S biogenesis protein. They appear to be involved in Fe-S cluster biogenesis. This family includes IscA, HesB, YadR and YfhF-like proteins. The hesB gene is expressed only under nitrogen fixation conditions [ (PUBMED:10217509) ]. IscA, an 11kDa member of the hesB family of proteins, binds iron and [2Fe-2S] clusters, and participates in the biosynthesis of iron-sulphur proteins. IscA is able to bind at least 2 iron ions per dimer [ (PUBMED:15050828) ]. Other members of this family include various hypothetical proteins that also contain the NifU-like domain ( IPR001075 ) suggesting that they too are able to bind iron and are involved in Fe-S cluster biogenesis. The HesB family are found in species as divergent as Homo sapiens (Human) and Haemophilus influenzae suggesting that these proteins are involved in basic cellular functions [ (PUBMED:8875867) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Fe-S_biosyn