The domain within your query sequence starts at position 110 and ends at position 422; the E-value for the Fe_hyd_lg_C domain shown below is 4e-85.

RLVVVSISPQSRASLAARFRLDPTDTARKLTSFFKKIGVHFVFDTAFARNFSLLESQKEF
VQRFREQANSREALPVLASACPGWICYAEKTHGNFILPYISTARSPQQVMGSLVKDFFAQ
QQLLTPDKIYHVTVMPCYDKKLEASRPDFFNQEYQTRDVDCVLTTGEVFRLLEEEGVSLT
ELEPAPLDGLDLSCVAPPALTRPSPRTSSVSAEEPSSHRGGGSGGYLEHVFRHAAQELFG
IHVAEVTYQPLRNKDFQEVTLEREGQVLLRFAVAYGFRNIQNLVQKLKRGRCPYHYVEVM
ACPSGCLNGGGQL

Fe_hyd_lg_C

Fe_hyd_lg_C
PFAM accession number:PF02906
Interpro abstract (IPR004108): Proteins containing this domain may be involved in the mechanism of biological hydrogen activation and contain 4FE-4S clusters. They can use molecular hydrogen for the reduction of a variety of substances.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Fe_hyd_lg_C