The domain within your query sequence starts at position 25 and ends at position 91; the E-value for the Feld-I_B domain shown below is 4.6e-34.

CASFFGVYLSTVSGKRLWLHHELSYFNPTDGETKSFKKIQDCYEEAGLKAKSQDVQFMAS
MFFSSEC

Feld-I_B

Feld-I_B
PFAM accession number:PF09252
Interpro abstract (IPR015332):

Allergies are hypersensitivity reactions of the immune system to specific substances called allergens (such as pollen, stings, drugs, or food) that, in most people, result in no symptoms. A nomenclature system has been established for antigens (allergens) that cause IgE-mediated atopic allergies in humans. The nomenclature system uses the first three letters of the genus, followed by the first letter of the species name, followed by a number (additional letters can be added to the name as required to discriminate between similar designations).

Fel d 1 is allergen 1 from Felis silvestris catus (Cat), which is an important agent in human allergic reactions [ (PUBMED:17543334) ]. The protein is expressed in saliva and sebaceous glands. The complete primary structure of Fel d 1 has been determined [ (PUBMED:12851385) ]. The allergen is tetrameric glycoprotein consisting of two disulphide-linked heterodimers of chains 1 and 2, which have been shown to be encoded by different genes. Fel d 1 chains 1 and 2 share structural similarity with uteroglobin, a secretoglobin superfamily member; chain 2 is a glycoprotein with N-linked oligosaccharides.

This entry includes major allergen I polypeptide chain 2 (Fel d 1 chain 2) from cat and related proteins, such as SCGB2B from mice.

SCGB2B is an androgen-binding protein that plays a role in mate selection in mice [ (PUBMED:22155607) ].

GO component:extracellular space (GO:0005615)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Feld-I_B