The domain within your query sequence starts at position 12 and ends at position 82; the E-value for the Fer2 domain shown below is 1.6e-10.

FFVNGKKVIEKNPDPEKNLLFYTRKVLNLTGTKYSCGTGGCGACTVMVSRYNPKTRKIHH
YPATACLVPIC

Fer2

Fer2
PFAM accession number:PF00111
Interpro abstract (IPR001041):

Ferredoxins are small, acidic, electron transfer proteins that are ubiquitous in biological redox systems. They have either 4Fe-4S, 3Fe-4S, or 2Fe-2S cluster. Among them, ferredoxin with one 2Fe-2S cluster per molecule are present in plants, animals, and bacteria, and form a distinct Ferredoxin family [(PUBMED:2065785)]. They are proteins of around one hundred amino acids with four conserved cysteine residues to which the 2Fe-2S cluster is ligated. This conserved region is also found as a domain in various metabolic enzymes.

Several structures of the 2Fe-2S ferredoxin-type domain have been determined [(PUBMED:8586613)]. The domain is classified as a beta-grasp, which is characterised as having a beta-sheet comprised of four beta-strands and one alpha-helix flanking the sheet. The two Fe atoms are coordinated tetrahedrally by the two inorganic S atoms and four cysteinyl S atoms.

GO function:electron transfer activity (GO:0009055), iron-sulfur cluster binding (GO:0051536)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Fer2