The domain within your query sequence starts at position 55 and ends at position 168; the E-value for the Fer4_20 domain shown below is 4.6e-35.

LESNFDDIKHTTLGERGALREAVRCLKCADAPCQKSCPTSLDIKSFITSIANKNYYGAAK
LIFSDNPLGLTCGMVCPTSDLCVGGCNLHAAEEGPINIGGLQQFATEVFKAMNI

Fer4_20

Fer4_20
PFAM accession number:PF14691
Interpro abstract (IPR028261):

Domain II of the enzyme dihydroprymidine dehydrogenase binds FAD. Dihydroprymidine dehydrogenase catalyses the first and rate-limiting step of pyrimidine degradation by converting pyrimidines to the corresponding 5,6- dihydro compounds [(PUBMED:11796730)]. This domain carries two Fe4-S4 clusters.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Fer4_20