The domain within your query sequence starts at position 1991 and ends at position 2095; the E-value for the Ferlin_C domain shown below is 6.7e-25.

CVTEEGEKKMLAGKLEMTLEIVAESEHEERPAGQGRDEPNMNPKLEDPRRPDTSFLWFTS
PYKTMKFILWRRFRCAIILFIILFILLLFLGVFVYAFPNYAAMKL

Ferlin_C

Ferlin_C
PFAM accession number:PF16165
Interpro abstract (IPR032362):

This domain is found at the C terminus of proteins belonging to the ferlin family, including dysferlin, myoferlin, otoferlin and fer-1-like proteins [(PUBMED:20667140)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ferlin_C